dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_015118710.1.44015 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment Cadherin domain-containing protein,putative calcium-binding protein [Rivularia sp. PCC 7116]; AA=GCF_000316665.1; RF=na; TAX=373994; STAX=373994; NAME=Rivularia sp. PCC 7116; strain=PCC 7116; AL=Complete Genome; RT=Major
Sequence length 1036
Sequence
MAATVLNPGDIAIVGYITNGSPDSFSFVPLVDLSAGTEIYFTDSGWKGNEFRDTEGTKKF
TVDNDIAAGTVIRSTEQSSDFTWENVSRSLNLSGSGDQIAAVQSNNLDSPLSSDFTAIYQ
VDYTGSFEDADTASTGNIITGLSEAENTAVLLNDTAKYAYFDFDAIPNGTREDWLATINN
PENWTFSDDGTTLPSGSIEVISEVSANNLVVTNTNDSGEGSLRQAIENANNLEDVDTITF
DASLSGETITLTSGELLVTDAVTIQGLGANQITISGNNSSRIFKIDNNDSGNQIDVTIDS
LSITGGQTPEGDDANDDGAGIWNRENLTLKNVVIRNNQAADDGGGIRNDGEITIIDSTVA
DNTSIGTSDTSGGGGLLNTIGASATVINSTFSNNEAKNGAGIRNDDNLTLINSTLSGNTA
SESGGGLANTINPNDFRNPASGGKATISNSTITNNTAEDSSGNGANSQVGGGIANFGIAT
VSNSIIAKNTNDDDFKNLVFGQSNSNGNNLIGNGEGVAAFTNGNNEDIVGTAAAPIDPLL
DVLKDNGGATQTHALLADSQAINAGSNTKLVGDSFDLDGDGNTTEQIPFEQRAEGFERIV
DSVVDIGAYEYSIGNTASQAPGITANQSFPIDENSKKGTFVGRVIATDPDSNTLSNWQII
DGNLDVDGDGKDAFAINSRTGNITVNDADDLDFENNPSFQLQLSVSDGTNTSNPATVTIN
LNDVAGSEINGTSENDRLNGSPEDDVIDGKEGNDFLYGYTGNDTLLGGSGNDNLYGGEGD
DSINGGDGTDTLRETADVDFNLTNTTLTGNGTDTFENIERVALTGGDSANTINASAYSGR
VTLSAKAGNDTLIGGIGNDVLSGGEGDDSINGGAGTDTLRETADTNFTLTNNQLESAATG
IDTFENIERVALTGGDSANTIDASAYSGSAFLYGKAGNDTLIGGSGNDVLSGGEGDDSIN
GGAGTDTLRETADTNFTLTNNQLESAATGTDTFENIERVALTGGDSANTINASAYSGRVT
LSAKAGNDTLIGWYWK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]