dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_015141423.1.5551 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment subtilisin-like serine protease [Nostoc sp. PCC 7524]; AA=GCF_000316645.1; RF=na; TAX=28072; STAX=28072; NAME=Nostoc sp. PCC 7524; strain=PCC 7524; AL=Complete Genome; RT=Major
Sequence length 616
Sequence
MRKLIILCLFVIGLVSAVFGFLNFQGLAAKGEFETILLDFREDIPAEVIKQDLQAIAQKY
NVTPQLDNKFSAQDNVYIIKGDRDRLKELKKSPFAKATEIIEPNYIYKLIEPAAKPTWLG
ELLRPQDSEEVQPSLTAPNDEYYSKQWNLHKIGVESAWSQTKGSGVTVAVIDTGVTKVRD
LYETKFVKGYDFVNDKEEASDDNGHGTHVAGTIAQATNNKYGVAGIAYEAKLMPLKVLSA
YGGGTVADIAEAIKFAADKGADVINMSLGGGGESQLLKQAIDYAHSKGVVIIAAAGNENE
NSAAYPARYPYVIGVSAFGPDGEKAPYSNFGAGVDISAPGGTDAGAILQETINEEGESVF
LGLQGTSMASPHVAGVAALVKAKGIQEPEEILKVLKQSARVIKDDSLNYYGAGQLNAEAA
VKLATDGQISFQDFFRWLRDNGYLNPGFWIDGGAVALLPKILMVVGSYLLAWFLRVYFPF
AWSWSLSSGLIFGSSGLFFLQGIYIFDLPQWPFRVLGSSIPELGNTIQGTGALNPIFASV
LIPIVLMALLLGHPNWKWFAIGSTLGVAACLTVSAVLDPAVWGLGSENLARIFLIANALL
CYGLARLALKNEGQTA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]