dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_015164730.1.5078 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein [Pseudanabaena sp. PCC 7367]; AA=GCF_000317065.1; RF=na; TAX=82654; STAX=82654; NAME=Pseudanabaena sp. PCC 7367; strain=PCC 7367; AL=Complete Genome; RT=Major
Sequence length 744
Sequence
MAIITVTTTLDVIAADGLTSLREAIIEANANADAADTIILESGLTYDLTLVGAGEDAAAT
GDLDIDSVVAGANITIETDGAAQATVDATALGDDRILDVLNADATLNIDNLILTGGNVTA
AGEDGGAIDLITGATLNVTDSEITGNTAADNGGGIAGDADNTITITNSLITGNEATGSDG
GGVYFDDNGNLTVTNSTVSNNTANTDGGGIHFDADGTATITNSLITGNEATGSDGGGVYF
DDNGTLTLTDSTVSNNTAGGDDGGGIHFDADGTATITGSTITGNTASDDGGGFYTDNRGN
LTLTDSTISNNTATGDQGGGIHLDNDSTATISTSTISGNSAGSDGGGSFFDNNSTIDITD
STFSGNEAGDESGALEADTPTLTISNSTFSGNTAATAGGAIQIDDGGTVDISHTTIAFNT
ATTNAGGIDLNDATITLNINNTIVATNEAPVGPDIDNTVGATITSGGFNIIGDNTDVAAD
FPAGIPNANDDFVGTAMDPIDPGLSPLADNGGPTQTHALGDGCSLAINNGDPNFVAPPDF
DQRGMGFDRVFGGRIDIGAFELQNSAGVLVFGNTSFGTPGPDTIVGDANNNTINGNGGDD
SLFGSDGIDRVNGGLGNDFLGGGLGNDFLNGGAGNDTMDGACGGTGTGEFDRLTGGGGAG
ADTFILGASFGSYYLGNGDADFAYISDFNSGVDTIVLNGVLADYTFVPNTTSNNVTGQGI
FNGGDLVAIVQQQAINTVTDLVFV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]