dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_015167464.1.58188 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment ribulose-phosphate 3-epimerase [Synechococcus sp. PCC 7502]; AA=GCF_000317085.1; RF=na; TAX=1173263; STAX=1173263; NAME=Synechococcus sp. PCC 7502; strain=PCC 7502; AL=Complete Genome; RT=Major
Sequence length 229
Sequence
MAPKSTVIAPSILSADFSRLGDEIRAIDAAGADWIHVDVMDGRFVPNITIGPLVVEAIRP
VTKKPLDVHLMIVEPEKYVADFAKAGADHIYVHAEHNASPHLHRTLGQIKELGKLAGVVL
NPGSPLELIKYSLELCDLVLIMSVNPGFGGQSFIPEVVPKIRELRQLCDEKGLDPWIEVD
GGLKANNTWQVLEAGANAIVAGSAVFKAKDYAKAIADIRNSKRPELVLA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]