dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_015173748.1.54702 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment orotidine-5'-phosphate decarboxylase [Geitlerinema sp. PCC 7407]; AA=GCF_000317045.1; RF=na; TAX=1173025; STAX=1173025; NAME=Geitlerinema sp. PCC 7407; strain=PCC 7407; AL=Complete Genome; RT=Major
Sequence length 239
Sequence
MSSMADRIIVPLDVPTEAAAIALLDRLPQVGFWKVGLELFVSSGPSILTVLKERDKRIFL
DLKFHDIPNTVKGACHAAGRYGVDLLTVHAANGKEGLRWAKEAAEAGALETGVLAPRLLA
ITLLTSINARTLAFDLKVPLELPEYVLNMALLAQESGIDGAVCSPQEVQQLRSMCENDFL
LVCPGVRPSWAETGDQKRTMTPAEAVKAGANYLVIGRPITAAPDPAEAFGRICDEMASV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]