dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_015186370.1.75295 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein [Microcoleus sp. PCC 7113]; AA=GCF_000317515.1; RF=na; TAX=1173027; STAX=1173027; NAME=Microcoleus sp. PCC 7113; strain=PCC 7113; AL=Complete Genome; RT=Major
Sequence length 419
Sequence
MYQLLALPYLSLSADILSRFTVRIHSRIVEKGRPWVRLWYFCRAFDQDGSGYLRLPILTI
SQLLEAAPSSIYQWLREGKAAGAFRWWKCQRGKLRVALGGLFAVCRDLISDSDSGKQRHA
PWGTPSEVGLHEILTLQKLRAAATVATTQRLQQLSRFAAWRKLPGPARKIYKLPQPDAFF
PSEEAQRLSDNHAKGSIRCVIHIGKRRVWTSRGFIPFGVSQQTIANERGIADRTVRRHLA
LMNVDRRQVVQSKSEYKLAADCLHHDGGAVEPSEDVNLRSSVDGSYYLSEKGLGGYNTIK
VGEVGFHRISSRFFTYGAKPKVWLYRCNIYQPRAKLCTMSSRRSEYRRLSGAHSAPTAML
PPLCQPLNVSLGDLLAEAGGHTTTFSRRGGVTSCNRPLNSFENSDRIDAIPAEKEGHFS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]