dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_024082485.1.53948 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: NADH:ubiquinone reductase (Na(+)-transporting) subunit F [Pseudomonas]; AA=GCF_001060745.1; RF=na; TAX=43306; STAX=43306; NAME=Pseudomonas denitrificans (nomen rejiciendum); strain=1269_PDEN; AL=Scaffold; RT=Major
Sequence length 406
Sequence
MGFEIFLAIGMFTAIVLGLVAIILVARAKLVSSGDVTIQINGEHSLTVPAGGKLLQTLAA
NNVFLSSACGGGGTCAQCKCVVVEGGGEMLPTEESHFTRRQAKEGWRLSCQTPVKQDMQI
RVPEEVFGVKKWECTVESNPNVATFIKELTLRLPDGESVDFRAGGYVQLECPPHVVEYKD
FDIQSEYRGDWDKFNMWRYVSKVDETVIRAYSMANYPEEKGVVKFNIRIASPPPGSDLPP
GQMSSWVFNLKPGDKVTVYGPFGEFFAKDTEAEMVFIGGGAGMAPMRSHIFDQLRRLKSN
RKISFWYGARSLREAFYTEEYDQLQAENPNFQWHLALSDPQPEDNWTGLTGFIHNVLFEN
YLKDHPAPEDCEFYMCGPPMMNAAVIKMLTDLGVERENILLDDFGG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]