dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_001007314.1.55412 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment WH1 domain protein [Tetrahymena thermophila SB210]; AA=GCF_000189635.1; RF=representative genome; TAX=312017; STAX=5911; NAME=Tetrahymena thermophila SB210; strain=SB210; AL=Scaffold; RT=Major
Sequence length 449
Sequence
MSQIQQQNSRAVPEEVKKLLQQVIGNKQTIMSIAIARIFTARSEGEWIYSNLQGILCLVW
DREKDNTPFLRLFDIETFDLLFEAEMYIDFHLSYASVNPTFYMFEYMNAFIGLQFISDSE
ASQFSLKVMTQSLKDVKPEQNIQQQQQPKEKKKEEKEGLFGFRKGLKKIVSNLFQKDGKH
NQDAENIEISKPISFQKVTSLQFNIKTNQFDFSNLNDEWKQIFSRAGIQQSDLSNEELAP
IIFESVIRFQSHYENQIENKQKESQQQQQQPNQQSNNNTQSTKQQNQTINEASQSIPVAP
QINMNIPPPPPMNLNIPPPPPINIPSAPVLDFNSSIKNNNIPAAPVIPNINDDKNRISIS
TQNKNFDSSQVMNKSSLLDQIKTGNFQLKHVEVNKKDNKANLDISQMDDQAQENLTLYLS
KCIAERRKQIRKHKYSSSEESNDSDDDDD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]