dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_001999627.1.58863 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment uncharacterized protein Dmoj_GI22969, isoform A [Drosophila mojavensis]; AA=GCF_000005175.2; RF=representative genome; TAX=7230; STAX=7230; NAME=Drosophila mojavensis; strain=TSC#15081-1352.22; AL=Scaffold; RT=Major
Sequence length 367
Sequence
MAFAGLKKQINKANQYMTEKMGGAEGTKLDMDFMDMERKTDVTVELVEELQLKTKEFLQP
NPTARAKMAAVKGISKLSGQAKSNTYPQPEGLLAECMLTYGKKLGEDNSVFAQALVEFGE
ALKQMADVKYSLDDNIKQNFLEPLHHMQTKDLKEVMHHRKKLQGRRLDFDCKRRRQAKDD
EIRGAEEKFAESLQLAQVSMFNLLENDTEHVSQLVTFAEALYDFHSQCADVLRGLQETLQ
EKRAEAESRPRNEFVPKTLLDLNLDGGGGGLIDDGTPSHISSSASPLPSPMRSPAKSMAA
TPHRQQQPCCQALYDFDPENPGELGFKENDIITLLNRVDDNWYEGAVNGRTGYFPQSYVQ
VQVPLPN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]