dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_002013498.1.64850 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment GL24170 [Drosophila persimilis]; AA=GCF_000005195.2; RF=representative genome; TAX=7234; STAX=7234; NAME=Drosophila persimilis; strain=MSH-3; AL=Scaffold; RT=Major
Sequence length 1267
Sequence
MNHQNYGGIQWIQQHPAASDSGVDILVGDGVTPDGYHLVTDEATGEDLDHMAAENLIFMA
RDGQLSEIIAGGNAVIVTADGHGVTYADSFDDDAQVVTEEVITDDWVQHQGAERVEIAAE
QIAGNGSSQELLDMEQDEYTALRPYPCDFCSRRFKKKSSLNTHMLAHQNDRPHLCKLCGS
RFSRRAELISHFKAHAEAQDAADAEAAAATSIKFEHRPMDDHYYEHEWPLYQQDQDAEDQ
QHYRRCSSADARTDQSPEAKGGSSLQIAISDKTEAPEMQDYMQSEPMQAVVTTSTAIEPP
PKADLPQPNYPVLDDSKPFVCQQCGLAFAREKALFSHTKNHRVDSPFECNQCQEMFWDNS
SLLEHQKTHQFEESNSEYDPASGDDSVSESEPDQLYGDFYCSECGICFHRQDLLRRHAKC
HFQQPDASNFDQKPIVGEVGVTDEVIAGDAENAKDDAAHRCHTCGKCFPNSVALSAHAEI
HARFPLFKCVLCGVSFYEEQAIKRHLHSRHPNELKANSCVLCGKECRDRKALIKHAWDHS
REKCHSCSKCGKNFHNKARLKRHMASHRDKSVVCEVCQEEFPDGRTLSNHRHSHSTTSPG
KLFPCLECGKTFGSRSSQQIHVRIHTGERPYGCRYCWKAFADGGTLRKHERIHTGEKPYA
CSVCPRAFNQRVVLREHIRSHHSGMDVTLGTYHCEVCSEDLSSSSELIQHLIKHSDTNTA
KQRQPVTGPRKYKRRRKLQPHEIAHMRAENKEDELLQEAEEYNSDLDICDFDVENVDQIF
EMAESPKKEKRKKGASKDPQAVANGTAKAVTDKSKMRYDSTSSHSDRMWEEKFLHDNQVS
LFQIDSLTAMNQQQSPLPTSTASSSSVQNTRRSSKQSQAQGQAKTAPPVEVKANPSASSS
STTASSSSRSRKKAGTSKAASSKSAAAGSSRPRMIHTEKAKVPKAAENSGTASGSTKKTR
GKSYITRTETSNLDLLSSSGSGKSRSTASNMVDDYEIISPATHPPNQISSSPLHIKQEQE
QQRVPMMYDDNLLIDAALLREKTYERFNPAIVNDLEEILRSPLKSEHNSRLRFTSESSTT
PQFLPGEEQNLIKIEPTSPDLREMVESQQRVTATTGNTPSSSSSSARTSRHLRQITANSP
RVGSKRSSSSRPDSASGAAAKKPTTSSSSSPVAAGSKTRSSEHSYLSYGVGVDSYNVNVP
ASANTADVSSAFFSISEVVSAADAADAAAKAAAASKSDRKKRSFECEMCSAIFYDRAQLL
DHVHIHI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]