dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_002410054.1.51680 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment conserved hypothetical protein, partial [Ixodes scapularis]; AA=GCF_000208615.1; RF=representative genome; TAX=6945; STAX=6945; NAME=Ixodes scapularis; strain=Wikel colony; AL=Scaffold; RT=Major
Sequence length 472
Sequence
NCSGHGECHQGICFCEVQYSGGTCTDPNISYFVAFSTIFYLICAVSFVQLLICIRSEFSR
IKPPSLLKALKVTTQKALYALICIATFARGFYFSSPENASLDWASSLMSAYYPLLLTGSS
LIVCFWAEVFHLRDLRHDKPRFLSKSFLGFLAFNIITYSLLLAELVLIQFAGYGETERVS
FFTFCTVVLSRSVVGWGNFSPLFYGKLCEILPPSVLQVRGAFVAGPPSAPNMSQVHQSRL
GLVAFAILLLTTVLFILSDVMGSFWKDKVAVLGRNCHDVMFRVIEMGLALWFPCVLWNCV
QPQQLWILNPKKLLVRREPDKTPPTGPESEALFSVPKELAKSGGDSLEKLPECFICYDSD
RTDAGPLIRPCNCKGDVSVVHHDCLRTWLIESAGNADSNRCKVCNEEYELERGEVWLPSG
LSPAHWLQTAAVLVIMGSAVSGACLVVKVFDNVGIRTLAVGLALLAEYVCLR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]