dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_002638529.1.8413 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment C. briggsae CBR-TWK-35 protein [Caenorhabditis briggsae]; AA=GCF_000004555.1; RF=representative genome; TAX=6238; STAX=6238; NAME=Caenorhabditis briggsae; strain=AF16; AL=Chromosome; RT=Major
Sequence length 557
Sequence
MLLSHGESRQSFKQKKAEEKRRRSSSGHGPQAKQSLAVLAQLMLPALIEEHTAQQEDVFV
PAHYRADGSLASTVTNRRHVLQRVNLLQRANCQMRKGAAGVWDIAGRAHLAGKRKVEQLQ
QKPPLWLVILNRAYHKYGLKHAVLILVFLVYCIAGGLIFWLIEEPFQSELRDKWHQKIYN
NRTERVDFMMKRIFNNSDFLIYIKGNTTTRLEQFFKEEFASYENQLGVKWSQQKMDWDFW
NAVLFAGTICTTIGYGHIYPMTDAGRLLTMCFALFGIPLMLLVLQDFGKLLTITMKFPWF
QTKRLMRRIMRCCTKQPIEEMREIERQERHDLDIFDLPLPVGIGLIVVWIFICSFVLSVW
DHNWTLLESFYFFFTSLSTVGLGDLVPSSPRLLITMFGFILVGLSLVSMVINLLQAKMKS
TYEAGRNDDKALTHHAHTLPTSLGVMQCYSADEEKKADVSERSLSRSTQTSLSLPGVRQV
VLRSDGVHWVNTDTSSPTKSPDEVTNLVEMETALRVCEQIGDNNNEEYSEGESLICETEV
LLELGECLSDLERCDSI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]