dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_004060270.1.27298 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: hematopoietic SH2 domain-containing protein [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence length 352
Sequence
MTEAGKLPLPLPPRLDWFVHTQMGQLAQDGVPEWFHGAISREDAENLLESQPLGSFLIRV
SHSHVGYTLSYKAQSSCCHFMVKLLDDGTFMIPGEKVAHTSLEALVTFHQQKPIEPRREL
LTQPCRQKDPANADYEDLFLYSNAVAEEAACPVSATEEASPKPVLCHQSKERKPSAEMNR
ITTKEATSSCPAKAPLGETRQKLWRSLKMLPERGQRVRQQLKSHLATVNLSSLLDVRRST
VISGPGTGKGSQDHSGDPTSGDRGYTDPCVATSLKSPSQPQAPKDRKVPTRKAERSVSCI
EVTPGDMSWHQMVVRALSSQESKPEHQGLADPENDQLPEEYQQPPPFAPGYC

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]