dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_004185937.1.21224 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein EIN_162250 [Entamoeba invadens IP1]; AA=GCF_000330505.1; RF=representative genome; TAX=370355; STAX=33085; NAME=Entamoeba invadens IP1; strain=IP1; AL=Scaffold; RT=Major
Sequence length 293
Sequence
MTETVGTKFNRKMFQLKTHLHMKEKTHDTDLRTAKARVTENKKLYKQILHCAEALPVQAF
TPVETMRQTAEMINDKKVVEILESVGKIGFETIEQDLVVPLREHIEHYDDVQRRIDDCHK
TRIDMDRHKEKLDNLLKKTNKQGRVSEFQIKYDAECDRYSKMRSEILEETRYLDEERDTI
ARPIMSSLLLCYTLYLDTVNDKWLQIRDVLKEVPPNFKFSKEENKIVPMMVTKEQTKPLC
TVQSLYDFDATQENELSLTEGDVVDVLEENGDWWYGEINGKRGYFPSNYVRTI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]