dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_004246657.1.44838 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: auxin response factor 18-like isoform X1 [Solanum lycopersicum]; AA=GCF_000188115.3; RF=representative genome; TAX=4081; STAX=4081; NAME=Solanum lycopersicum; cultivar=Heinz 1706; AL=Chromosome; RT=Major
Sequence length 694
Sequence
MITFMDPKEKVKEVEKCLDSQLWHACAGSMVQMPSISSKVFYFPQGHSEHASGNVDFRSS
IRIPSYIPCKVSAIKYMADPETDEVFAKIRLIPVGRNEVEFDDDGVVGMNGSDNQDKPSS
FAKTLTQSDANNGGGFSVPRYCAETIFPRLDYSADPPVQTILAKDVHGETWKFRHIYRGT
PRRHLLTTGWSTFVNHKKLVAGDSIVFLRAENGDLCVGIRRAKRGIGGGPETSSGWNPAG
GNCMVPYGGFSSFLREDENKLMRNGNGNNGGNLMNKGKVKAESVIEAANLAASGQPFEVI
YYPRASTPEFCVKSSLVKSALQIRWCSGMRFKMPFETEDSSRISWFMGTISSVQVSDPIR
WPDSPWRLLQVTWDEPDLLQNVKRVSPWLVELVSNMPTIHLSPFSPPRKKLRLPQHPDFP
LDGHLPMPAFSGNHLLGPNSPFGCLPDNTPAGMQGARHAQYGLSLSDLHFNKLHSSLFPV
GFPPLDQAAAAPRRPLNSPMISKPCNNENISCLLTMGNSAHSTKKSDIGKAPQLVLFGQP
ILTEQQISLSCSGDTVSTVRTGNSSSDGNADKIGNVSDGSGSALNQRGLTERSPCDTFQS
DPNTEIGHCKVFMESEDVGRTLDLSLLGSYEELCRKLANMFGIDNSEMLNHVLYRDTTGS
VKQLGDEPFSDFMKTARRLTILTDSSSDNVGIRE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]