dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_005085183.1.91757 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: wiskott-Aldrich syndrome protein [Mesocricetus auratus]; AA=GCF_000349665.1; RF=representative genome; TAX=10036; STAX=10036; NAME=Mesocricetus auratus; AL=Scaffold; RT=Major
Sequence length 515
Sequence
MSGVPVGGRPAGRGGPAVQQNIPSNLLQDHENQRLFELLGRKCWTLATAVVQLYLALPPG
AEHWTMEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYLTPTPFFHTFAGD
DCQVGLNFSDESEAQAFRALVQEKIQKRNQRQSGERRQLPPPPAPTNEERRGGLPPLPPH
PGGDHGGPSGSPISLGLVTVDIQNPDITSSRYRGLPAPGPGPADKKRSGKKKISKADIGA
PSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGI
EAVRQEMRRQEPLPPPPPPCRGGGGGGGGGEGGGSQLLRPPIAGSNKGRSGPLPPVPGGG
APPPPTPRGPPPPGRGGPPPPPPPATGRSGPPPPPVPGAGGPPAPPPPPPPPPPPPPCTE
SGPAPPPLPPTSASARGPAPGGGRGALLDQIRQGIQLNKTPGAMENSVQQPPPQRSEGLV
GALMQVMQKRSRVIHSSDEGEDQTGEDEEDDEWDD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]