dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_005419557.2.5688 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: low-density lipoprotein receptor-related protein 5 [Geospiza fortis]; AA=GCF_000277835.1; RF=representative genome; TAX=48883; STAX=48883; NAME=Geospiza fortis; AL=Scaffold; RT=Major
Sequence length 1595
Sequence
MFPCFPSVASPFLLFANRRDVRLVDAGGTKLESTVVVSGLEDAAAVDFQYSQGIVFWTDV
SEEAIKQTYINQTGNVVQNVIISGLVSPDGLACDWIGKKLYWTDSETNRIEVANLNGTSR
KVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDSSMRKIIVDSDIYWPNGLTI
DLDEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHA
CNKQTGEKRREILSALYSPMDIQVLSPDRQPYFHTPCEENNGGCSHLCLLSPRDPFYSCA
CPTGVQLEDDGRTCKAGAEEVLLLARRTDLRRISLDMPDFTDIILQIDNIRHAIAIDYDP
VEGYIYWTDDDVRAIRRAYLDGTGAQTLVTTEINHPDGIAVDWVARNLYWTDTGTDRIEV
TRLNGTSRKILISENLDEPRAIVLNPVMGYMYWTDWGESPKIECAYLDGSERRVLVNTSL
GWPNGLALDLEKNKLYWGDAKTDKIEVINIDGTMRKTLLEDKLPHIFGFTLLGDYIYWTD
WQRRSIERVHKIKASRDIIIDQLPDLMGLKATSVTKAFGTNSCAENNGGCSHLCFFTPQE
ARCACPIGLELLSDMKTCIIPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDF
DVSDNRIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRI
EVARLDGQYRQVLVWKDLDNPRSLALDPTKGYMYWTEWGGKPRIVRAYMDGTNSITLVDK
VGRANDLTIDYVDQRLYWTDLDTSMIESSNMLGQEREIIADDLPHPFGLTQYSDYIYWTD
WNLHSIERADKTSGKNRTLIQGHLDFVMDILVFHSSRQDGLNDCVQNNGHCGHLCLAIPN
GFRCGCAAHYTLDPNSRNCSSPASFLLFSQKSAISRMIPDDQQSPDIILPMHGLRNVKAI
DYDPLDKLIYWVDGRQNIIKRAKDDGTQPFTVMSTPNQSQNPEKQPHDLSIDIYSHTLYW
TCEATNSVNVHRLSGESIGMVLRGEHDRPRAIVVNAERGYMYFTNMQERAPKIERAALDG
TEREVLFTTGLIRPVALVVDNKLGKLFWVDADLKRIESCDLSGANRVTLEDSNILQPMGL
TVLGNHLYWIDRQQQMIERVEKVNGYKRTRIQGRIAHLTGIHAVEELDMEEFSVHPCSRD
NGGCSHICIAKGDGTPRCSCPEHLVLLQNLLTCGEPPTCSPDQFTCATGEIDCIPMAWRC
DGFPECDDQSDEDSCPICSASQFQCEKGQCIDAHLRCNGEIDCQDKSDEADCDTICLPNQ
FRCASGQCILLKQQCDSFPDCIDGSDELMCEKLKPASDESQPHSSAIGPVIGIILSLFVM
GGMYFVCQRVVCQRYAGPNSPFPHEYVSGTPHVPLNFIAPGSSQHGTFTGISCGKSMISS
MSLMGGSSGAPLYDRNHVTGASSSSSSSTKATFYPQILNPPPSPATDRSLYNAEMFYSSN
IPSNTRSYRPYLIRGIAPPTTPCSTDVCDSDYTTSRWKANKYYIDLNSDSDPYPPPPTPR
SQYMSAEESCPPSPATERSYFHLYPPPPSPCTDSS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]