dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_005796338.1.87360 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: potassium voltage-gated channel subfamily D member 2-like isoform X1 [Xiphophorus maculatus]; AA=GCF_000241075.1; RF=representative genome; TAX=8083; STAX=8083; NAME=Xiphophorus maculatus; strain=JP 163 A; AL=Scaffold; RT=Major
Sequence length 622
Sequence
MAAGVAAWLPFARAAAIGWMPVASTPMPIPPQDKRKAQDGLIILNVSGTKFQTWRTTLER
YPDTLLGSTERDFFFHEETSEYFFDRDPDIFRHILNFYRTGKLHYPRQECISAYDEELAF
FGIIPEIIGDCCYEEYKDRRRENAERLQDDEEMDMNNDVTPVNLTFREYLWRAFENPHTS
TLALVFYYVTGFFIAISVMANVVETVPCGTLPNRSKEMSCGDRYALAFFCLDTACVMIFT
VEYLLRLIAAPSRCKFMKSVMSVIDVVAIMPYYIGLVMTDNDQVSGAFVTLRVFRVFRIF
KFSRHSAGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSTATKFTSIPAAF
WYTIVTMTTLGYGDMVPKTIVGKVFGSICSLSGVLVIALPVPVIVSNFSRIYHQSQRAEK
RRAQRKTRLARIRAAKIRGTNAYMRYKQNGLLIDALEEASKEAGQALVGKAASPPFESQH
HHLLHCLEKTTNHEFVDEQTFQANCMEISVVNKSGSRTSSLSSSPHGLSSCCSRRHRKKS
SFSLPSTNNQELSTIQIRERPVSNSRSSLNAKLDETMPLKCDEAYISPSMVRLSAPVATS
SDDASTATTTYSQSNIVRVSAL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]