dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_005836011.1.50599 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein GUITHDRAFT_136216 [Guillardia theta CCMP2712]; AA=GCF_000315625.1; RF=representative genome; TAX=905079; STAX=55529; NAME=Guillardia theta CCMP2712; strain=CCMP2712; AL=Scaffold; RT=Major
Sequence length 559
Sequence
MSVSQTAPVRQGRLLQRATWLLVLVLHALSFAFCHGCSVLISAEPHHDCQERTWVLEGGV
KGHWSQGIDILVFECEMVNLVLMASGCEAAEQQPVKVRIDTGEHFIHRGSYTSSEQPSFR
LEIPGVSESGIDVPLLHLADGMYNLTAHFGHPLHLAASTMFAKLSPHVNPALEVMFPPQR
YTFGNDMEPFLQVYVQDRDASIAASGTTAGASKQLAFYLNITIRRLEGEEVVEEKTVMEW
SPNSRKIFLGRHMEASGTYKIEMVIYDAVLRPTDAREEVLVMISHSSRSPLACIAGEPEC
TPQATDRTGEEWFQGGNHSTFLDRLVDAVQSHCPQISPQDRHCRDKEQDACSGHGWCLDS
FCYCYQDYAGPKCDTHLLSALQYLPSSYPTQDVSHCHQSIALSRGMEGLSRTYNALQNPA
VCDDSKSIQRRFNKTQGLGVTFRWLSLSLLLSLAEQKTLLIGGKWRAFNFEGCSDRGLWC
YLLPSSNCSVSSWRWEEISEKDFYMPQVLVVPSEGIDQGQLWWSSQMTHLIMRPSVDLKE
KVRRIKVKEEEEEEEEEED

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]