dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_005891410.1.15283 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: dual specificity protein phosphatase 21 [Bos mutus]; AA=GCF_000298355.1; RF=representative genome; TAX=72004; STAX=72004; NAME=Bos mutus; AL=Scaffold; RT=Major
Sequence length 196
Sequence
MTTPLCPFPIQAVRQPAAHGLSQITKSLYLSDAVAAKDKAMLSTNHITTVINVSMEATDT
FLEDIQYVKVPLADAPNSRLYDFFDFIADHIHSVEMKQGRTLLHCAAGVSRSATFCLAYL
MKYHSMSLLDAHTWTKSCRPTIRPNNGFWEQLIYYEFKLFSKNTVHMISSSMGMIPDVYE
KEICLMTLMGVIPDSS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]