dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_006087799.1.53796 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: myotubularin isoform X3 [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence length 603
Sequence
MASAPTSKYNSRSLENESIKRTSRDGVNRDLSEAVPRLPGEIRITDKEVIYICPFNGPIK
GRVYITNYRLYLRSLETDSALILDVPLGVISRIEKMGGATSRGENSYGLDITCKDMRNLR
FALKQEGHSRRDMFEILTRHAFPLAHSLPIFAFVNEEKFNVDGWMVYNPVEEYRRQGLPN
HHWRITFINKCYELCDTYPPLLVVPFRATDEDLKRVATFRSRNRIPVLSWIHPENKTVIV
RCSQPLVGMSGKRNKDDEKYLDVIRETNRQISKLTIYDARPSVNAVANKATGGGYESDDA
YHNTELFFLDIHNIHVMRESLKKVKDIVYPNVEESHWLSSLESTHWLEHIKLILTGAIQV
ADKVSSGRSSVLVHCSDGWDRTAQLTSLAMLMLDSFYRSIEGFEILVQKEWISFGHKFAS
RIGHGDKNHADADRSPIFLQFIDCVWQMSKQFPTAFEFNERFLMTILDHLYSCRFGTFLY
NCESARERQKVTERTVSLWSLINSNKDTFKNPFYTKEINRVLYPVASMRHLELWVNYYIR
WNPRIKQQQPNPVEQRYMELLALRDEYIKRLEELQLANSAKLSDPSTSPSSPSQMLPHVQ
THF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]