dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_006113168.1.96668 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: merlin isoform X1 [Pelodiscus sinensis]; AA=GCF_000230535.1; RF=representative genome; TAX=13735; STAX=13735; NAME=Pelodiscus sinensis; AL=Scaffold; RT=Major
Sequence length 644
Sequence
MSIRGLKKKQPKTFKVKVITMDAEMEFSCEMKWKGKDLFDLVCRALGLRETWFFGLQYTI
KGMSTWLKMDKKVLDQEIPKEDPVSFRFLAKFYPEKVEEELLQEITQHLFFLQVKKQILD
EEIYCSPEATVLLASYAVQAKYGDYDPNFHEPGFLAQDELLPKRVLRQYQMTADMWEEKI
SAWYAEHRGIARDEAEMNYLKIAQDLEMYGVNYFPIAQNKNDTDLLLGVDAKGIHVYSRN
NRLSPNKSFEWSGIRNISYSEKELTIKPLDKKAEVFKFFSSQLKVNKLILQLCIGNHDLF
MRRRKVDSIEIQQMKAQAREEKARKKMETQRLAREKQLREEAERAKEELERRLFQLEDEA
RQANEALLRSQETAELLAEKAQIAEEEAKLLAQNAAEAEQERQRLEITALKSKEEKRLME
QKMRETELIAVKLVKESDRRAKEAEHLKQDLHEAREAERKAKQKLLDVTRLNYPHVAQYS
SHSPADTRDVNLDKGSGKMDLKDVDLKRLSFEIEKERLDYLEKSKKFEDRLKELKSEIHA
LKLEEKQTGLYSHWNEVLGSLGNAPSWMKSFEAADLLDINLRKAFPAYPLTATSSWPCTN
KSQQAVPVEKSAFQTNALVASSVGTGSRKQMIKVQQHDSDVIYI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]