dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_006280875.1.15642 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein CARUB_v10026867mg [Capsella rubella]; AA=GCF_000375325.1; RF=representative genome; TAX=81985; STAX=81985; NAME=Capsella rubella; cultivar=Monte Gargano; AL=Scaffold; RT=Major
Sequence length 300
Sequence
MAATLLTTAAAVASSQTTSGLLTKRPVFLPARTVCRFNGLCFNKRSLVVKSKRPFSCNAI
YNPQVQTIQEGQSESLDYRVFFQDGSGKKVSPWHDIPLHLGDGVFHFIVEIPKESRAKME
VATDEAFTPIKQDTKKGKLRYYPYNINWNYGLLPQTWEDPTQANSEVEGAFGDNDPVDVV
EIGETRRKTGEVLKVKPLAALAMIDEGELDWKIVAISLDDPKAHLVNDVDDVEKHFPGTL
TAIRDWFRDYKIPDGKPANKFGLGNKPANKDYALKIIHETNESWAKLVKRSVSPGELSLF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]