dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_006379969.1.11743 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein POPTR_0008s18530g [Populus trichocarpa]; AA=GCF_000002775.3; RF=representative genome; TAX=3694; STAX=3694; NAME=Populus trichocarpa; AL=Chromosome; RT=Major
Sequence length 134
Sequence
MPAGVAVIPLALRVHNRDHWFYLALVVLVSACLCALILSTPVATFCALTRAATAGLLIKG
RFLRVSSIESKSSHPMAAALVDYGRWHSVKPKPEDLEEFQKFPGEGIQGKNEVKNICIDN
RKIAHRASGTGEKP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]