dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_006429019.1.91645 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein CICLE_v10012723mg [Citrus clementina]; AA=GCF_000493195.1; RF=representative genome; TAX=85681; STAX=85681; NAME=Citrus clementina; cultivar=Clemenules; AL=Scaffold; RT=Major
Sequence length 217
Sequence
MMAPPIETSSKTPVSQPPAHPPLNERILSSMSRRSVAAHPWHDLEIGPGAPKIFNCVIEI
GKGSKVKYELDKKSGLIMVDRVLYSSVVYPHNYGFIPRTLCEDNDPLDVLIIMQEPVLPG
CFLRAKAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKN
ENKEVAVNDFLPASDAYNSVQQSMNLYADYIVESLRR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]