dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_006630966.1.81211 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: twinkle protein, mitochondrial [Lepisosteus oculatus]; AA=GCF_000242695.1; RF=representative genome; TAX=7918; STAX=7918; NAME=Lepisosteus oculatus; AL=Chromosome; RT=Major
Sequence length 699
Sequence
MLRSGLFMKRAYSVLRVAVFHHRTLRHFSAPFLSLGGPRPPSLLQAQPRTPGLLLSCRTF
KKVLKTPSDLPASPVSVTDIKQYLRSKNIPFHDGYSCLHARSLFREPEGGAEGPERDSFS
MFIDKTTGQFLCKETQVEGSWEDLQDCVEVLQKERCSSLTPEVLLGYRESEEEQGEREAD
HREVLRIWASSVPLSELPDEETQLVRAMFGMGKISNATLKKFGVRFFKPTKGLVFPWFSA
WDSSLRGLKLLSAQRGGNDKVVYSEVTFPRPGAYRNLFGLHLVGRKDAEVVLTSQEVDTL
AVTQATGLPSVALPRGTSCLPPALLPYLEQFKKVFLWLGGDMRSWEASKIFSRKLGLKRC
SLVRPGEAQPCPSEALAQGKNLARILKAAIPAAHKSIVSFRQLREDVYGELANKDQVAGV
KWTRFPELNKILKGHRKGELSVFTGPTGSGKTTFISECALDLCMQGVSTLWGSFEINNVR
LAKIMLTQFSMQRLEDSLEQYDSWADKFEDLPLYFMTFHGQQSIKPVLDTMHHAVYLYDI
SHVVIDNLQFMMGQESLSVDKFALQDHIIGAFRKFATQNSCHVTLIIHPRKEEDDKELQT
ASIFGTAKASQEADNVLILQEKKLVSSPGRRSLQVAKNRFDGDVGIFPLEFDKASLTFSS
PKSKAWLRKVKSNKANEPEAREKGPAKSTGPGGAGNKKQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]