dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_006869129.1.41390 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: zinc finger protein 420-like [Chrysochloris asiatica]; AA=GCF_000296735.1; RF=representative genome; TAX=185453; STAX=185453; NAME=Chrysochloris asiatica; AL=Scaffold; RT=Major
Sequence length 671
Sequence
MVSGVDSVVFDDVAVVFSPEEWALLNLAQRKLYRDVMKETLSNLDSCESIDRVCRYQTLR
ECCEFGKAFKHPATSHVGFNICQCVECGETCSCPSHLTKHERTYNGERPYECKECGKAFW
HLSVFSKHIRTHSGERPYECQECGKTFSDSSILTKHIRTHGEVKPYECKECGKSFRQLST
LTEHVRIHSGERPYKCNECEKAFINASSLTEHIRTHNEEKPYECMECGKAFWHLSVLSKH
IRTHSGERPYECQECGKAFSQASSLTRHIRTHSGERPYECQECGKAFSDSSTLSRHVRTH
SEVKPYECKECGKSFKELSTLTEHVRIHNGERPYKCNECEKAFVNASSLTEHTRTHSGER
PYICKECGKAFTHASSLTEHIRTHSGERPYECKECGKAFWHLSVLSKHLRTHSGETPYEC
QECGKAFSQASSLTRHTRTHSGERPYKCKQCGKAFSDSSALTRHIRTHSGVKPYECKECG
KSFRQLSTLTEHIRIHSGERPYKCKECEKAFINASSLTEHIRTHSGERPYICKECGKAFT
HASSLTEHIRTHSGERPYECKECGKAFRQASSLIKHIRTHSGERPYECKECGKAFSQASS
LIKHKRTHTGERPYKCKECGKSFTHASSLTRHKRTHGRQRPYECKECGRSFRQLSALTKH
IITHWREALYM

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]