dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_008113811.1.98722 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: potassium voltage-gated channel subfamily G member 1 [Anolis carolinensis]; AA=GCF_000090745.1; RF=representative genome; TAX=28377; STAX=28377; NAME=Anolis carolinensis; AL=Chromosome; RT=Major
Sequence length 509
Sequence
MTLLPGENSDYDYSALSCASDASFNHPFFAETETLKGVFYQRAKLIHPGEDLYECIHPED
RKHHIIINVGGFKYLLPWTTLDEFPMTRLGQLKFCNNFDDILNICDDYDVTCNEFFFDRN
PGAFRTILTFLRAGKLRLLREMCALSFQEELLYWGIEENSLEWCCKRKYLQKMEEFAELN
ETEDEFIDSENQSDAVVETKAGLCMKKLQDMVERPQSGIPGKVFACLSVIFVTITAVNLS
ISTMPGLREEEERGECSQMCYNIFIVESVCVGWFSLEFILRFIQAPSKFVFLRNPLTMID
IVAILPYYITLFLDTASLGSNKKPSSGNIYLDKVGLVLRILRALRILYVMRLARHSLGLQ
TLGLTARRCTREFGLLLLFLCVAIALFSPLLYVIENEMTGSQEFSSIPASYWWAVITMTT
VGYGDMVPRSIPGQVVALSSILSGILLMAFPVTSIFHTFSRSYIELKQEQERIMYRRAQF
LMKSKSELSHASQGSDVFPSASSETREHD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]