dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_008337840.1.92800 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: methylthioribose-1-phosphate isomerase-like [Malus domestica]; AA=GCF_000148765.1; RF=representative genome; TAX=3750; STAX=3750; NAME=Malus domestica; cultivar=Golden Delicious; AL=Chromosome; RT=Major
Sequence length 382
Sequence
MAPHSEFTDGTQAPNSLQAICYKRGSLQLLDQTKLPLQSTYLDIRDSTDGWHAIKDMVVR
GAPAIAIAAALSLAVEIFNLEDFNGTPDEAFSFIVMKLEYLVSSRPTAVNLSDAAAKLKQ
IASAVATTTSDARNVFEAYIEASEIMLKDDVASNKAIGSHGASFIQNLLGNSKNISMLTH
CNTGSLATAGYGTALGVIRSLHTEGVLERAYCTETRPFNQGSRLTAFELVHDNIPATLIA
DSAAAALMKFARVNAVVVGAYRVAANGDTANKIGTYNLAVSAKHHNIPFFVAAPLTSVDL
SLSSGEEIIIEERSPKELLNTHGGLGEQVAAFGISVWNPAFDVTPANLITGIITEKGVIT
KKGTDAFDIKGFVQKEAVQASA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]