dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_009031501.1.102002 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein HELRODRAFT_166292 [Helobdella robusta]; AA=GCF_000326865.1; RF=representative genome; TAX=6412; STAX=6412; NAME=Helobdella robusta; AL=Scaffold; RT=Major
Sequence length 267
Sequence
MTRALYGRMARGTCVHTDFGYVGCFKDVLFLMERRQCIVGVPDREMSSLKPCNQDLKLYL
EAGYRCMKVHQATKKCDSQTSLNKLSHYQQQQQQQQQQHHYNKQLNNDNDNNYINSNNND
DSNKMKNNKISLLPNEIQVTNTAGYLPSILTAESGCGSHEHPWIIRALPGQKVRLKLIDF
SMKGTENGGEGGGGSDQKMYLTNCSVCAIVRDALMQTGTSLCRNYSRNSHVYTSLSHVIK
LRIIIGRENDVTPQFVFIYEGRQEECF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]