dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_009045563.1.39240 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein LOTGIDRAFT_171136 [Lottia gigantea]; AA=GCF_000327385.1; RF=representative genome; TAX=225164; STAX=225164; NAME=Lottia gigantea; AL=Scaffold; RT=Major
Sequence length 860
Sequence
MEMRNFLKFLILWCLPLCRGLGLDQWGNHFYLSFLVNVQNSDYIYLNVIVITTREQTTVR
INLNKLNTPVTEITLAPGQSYNLVLDESYKAVPVLEVIPKKAVVITSSAPVSVYGFTGRQ
TSNEGYLTLPVPSLGKQYIVVNYENGRPQIVVIAIEDGTTVTITLKGDNKCFYINGFKDY
VDGYAFTFTMNDADVVNIYCLYDSTGSIVASNKPVAMLSGNRCADIPSQSRCDHLVEMLP
PVSELGTKFIVVAPDFQTYNAAMRVVATQSSTTFTIKGIDYVLGNSDFQELSLIKGEVVC
FTSNKPVLVVVYMGGKDVDNGIDTYYHGDPLMMVVPPVDKYTTQYVMDSAQLNYNNIYAI
LVSQKESTNLITPSVTSGWSDVCSDHAYVIKSVSGFVSYESSDSLMVWMYGTEIRGGFGF
PGGFGLSDYSGVNECATNPCQNDGWCLEVGTTTRCNCGLEYTGSLCETVITTTAEPSTTT
EPSTTTEPSTTTEPTTTTEPTTTTEPTTTTEPSTTTEPTSTTEPTTTTEPTTTTEPTTTT
EPTTTTEPITTTEPTTTTEPTTTTEPTTTTVPTTTTEPSTTTEPTTTTEPTTTTEPTTTT
EPTTTTEPTTTTELTTTTEPTTTTETTTTTEPTTTTEPTTAEPTTSTEPTTTTEPNTTTE
PNTTTEPTTEPTASTEPTTTTEPNTTTEPNTTTEPNTTTEPTTEPTASAEPTTTTGATTT
TELTTTTELTTDEANFKPIFHKPCKLGSCQCACPCKIGTVTKLERVQNASKQIAKKLILP
KQTLSKTKRTKTSVYNTNQTEETLGISSFVFLGLFLLVFLLLDIPVNRIVNWIQMIGSGR
TRKRLNQANDSNHRRQYVSD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]