dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_010649790.1.54126 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: vesicle-associated protein 1-2 [Vitis vinifera]; AA=GCF_000003745.3; RF=representative genome; TAX=29760; STAX=29760; NAME=Vitis vinifera; cultivar=PN40024; AL=Chromosome; RT=Minor
Sequence length 293
Sequence
MELLEIQPRELKFTFELKKQSSCSIHLVNKSDQYLAFKVKTTSPKRYCVRPNTGVVKPNA
ECDVMVTMQAQRVAPPDMQCKDKFLIQSTVVPYGTTETDIRSDMFAKDSGKYLEEKKLRV
VLIGPAHSPVLLPLNGLLKQDPCHENFSQKDQLLSGVENTPPAHVVAKDVEGFKTAKVTD
ESRAAKDVESRPAEDVDELKLTNDIAKENLAKDIEELNSKLNVVELNLSEAKLIITKLTE
ERSMATREKETLKHELAMLRKKSDVRRVRVGFPFLFVLIIALIGIAAGYLMHS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]