dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_010858576.1.44457 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: centrin-4 [Bison bison bison]; AA=GCF_000754665.1; RF=representative genome; TAX=43346; STAX=9901; NAME=Bison bison bison; AL=Scaffold; RT=Major
Sequence length 166
Sequence
MASRPSSDQWKKNAAKIELNETQKQEIKEAFDLFDVDGSGTIDVKELKIAMRALGFEPKK
EEIKKMIAETDKEGIGTISFEKFFAIMSVKMSEKDEKEEILKAFKLFDDDDTGSISLNNI
KRVAKELGENLTDDELQEMLDEADHDGDGEINKEEFLKMMQKTTLY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]