dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_011242166.1.92730 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: potassium voltage-gated channel subfamily S member 3 isoform X1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence length 491
Sequence
MVFGEFFHRPGQDEELVNLNVGGFKQSVDQSTLLRFPHTRLGKLLTCHSEEAILELCDDY
SVADKEYYFDRNPFLFRYVLNFYYTGKLHVMEELCVFSFCQEIEYWGINELFIDSCCSSR
YQERKEESHDKDWDQKSNDVSTDSSFEESSLFEKELEKFDELRFGQLRKKIWIRMENPAY
CLSAKLIAISSLSVVLASIVAMCVHSMSEFQNEDGEVDDPVLEGVEIACIAWFTGELAIR
LVAAPSQKKFWKNPLNIIDFVSIIPFYATLAVDTKEEESEDIENMGKVVQILRLMRIFRI
LKLARHSVGLRSLGATLRHSYHEVGLLLLFLSVGISIFSVLIYSVEKDEHKSSLTSIPIC
WWWATISMTTVGYGDTHPVTLAGKIIASTCIICGILVVALPITIIFNKFSKYYQKQKDME
VDQCSEDPPEKCHELPYFNIRDVYAQQVHAFITSLSSIGIVVSDPDSTDASSVEDNEDAY
NTASLENCTGK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]