dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_012658198.1.62490 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: collagen type IV alpha-3-binding protein [Otolemur garnettii]; AA=GCF_000181295.1; RF=representative genome; TAX=30611; STAX=30611; NAME=Otolemur garnettii; AL=Scaffold; RT=Major
Sequence length 715
Sequence
MQRSSVLSPPSPCPAPPTLLPVVIRENRRGLSSGGGSGRNAGVTATAAATDGWKGRLPSP
LVLLPRAARCQARRRRRRSGRTSSLVLLPSAPVRALLASPSPDPSPRGLGAASRASQGVG
AGLLLGCRASMSDNQSWNSSGSEEEPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNN
TLSYYKSEDETEYGCRGSICLSKAVITTESGYGSESSLRRHGSMVSLVSGASGYSATSTS
SFKKGHSLREKLAEMETFRDILCRQVDTLQKYFDACADAVSKDELQRDKVVEDDEDDFPT
TRSDGDFLHNTNGNKEKLFPHVTPKGINGIDFKGEAITFKATTAGILATLSHCIELMVKR
EESWQKRLDKEIEKKRRAEEECEKAKMELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAA
LDRQDKIEEQSQSEKVRLHCPTPLPSGDAFSSVGTHRFVQKPYSRSSSMSSIDLVSASDD
VHRFSSQVEEMVQNHMNYSLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHA
VKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYL
SAIRKIPALTENDPETWIVCNFSVDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEIS
RDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]