dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_013088864.1.17457 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: zinc finger protein 208-like [Biomphalaria glabrata]; AA=GCF_000457365.1; RF=representative genome; TAX=6526; STAX=6526; NAME=Biomphalaria glabrata; AL=Scaffold; RT=Major
Sequence length 1406
Sequence
MTTNGETSKANGTDHEENLHSDFFNSGSEKELQNITTQFDVSDTFITIETKDGLSSKKIP
FSQFLKQVVIDKESGDLKVDFSQLIVSSNGAHKNIAEIISCEENASNKNITTSSPVISLS
NGDASTLSISQTHSGINSTLERPVKKRGRPPKKKPEDNATLQMDTISSSTALKSCTVPVA
GARQNILSMPRRSNRTPAKSSRFGDDYVNSLTLGKVSSSTLSNSTSTWNTQLMTLALAAE
RHKHKPNKPNSEHSGSDTDSVKDSDFGASDLTLEKKSPDKMGSIMDTDASDSAIYIKQVP
LKNNNLSHSKAELSSNGDRVTKAEEKMKKHNIRGPKTLKKYEPVDPVVKRTLQEALLHVT
QATRGHMSFSKPEMENSDCTNPTVYYTIMEPKMAPLGNGLLVQKSEDKINFRIIEFEGEI
SENSELSMTYPQDRYYSCDICCKIFPSLNSWLYHNQYSHNRTMKAFESFPASIGDRQEHV
CDYCHQSFPYSFMLDIHIKRKRHSEIKSFRCTLCRKGFASHKDREEHWLVHHPARSCGLC
GKEFTNIVMLRRHINNNCHGARFRKVPENEGLTADDNMVLSKYKSKMLVDTENEVEEERI
DYATMISENDDEDDFEEEDRVSGHENEKVRCGTCELEFSTSSRLWHHKIEDHREFYPEGF
RDTLQDKLTRYENMLLTASSTEIQKPADGNKNKFFTILKPAWPTEKPKLTISVEDKEFVF
KQNSPRQNILEEMTHNSYSDKKNTSFECLDCSETFLLASSYREHRSKMHGEYFEILKIMG
AFQCTLCSETFPCQFMLDKHVKKHVGKKVLPCTLCGVFFHKIQDRRLHWKTVHPGIGCPN
CGKMYASIKYLQKHISLNCQDHYPPTKKFLEFQKKQHSDFEMSKNEKKVDKKIIRCHLCP
KICSSIHGWRRHMSESHEDAGFSKLSNMCIICNELVYGYKALEKHLLQNHAEDSGLPVEE
EDGLVEEALKKCDIDITAYRKAGRNTSEIYQDEEGNYHCPNCTKVHSDLKALRTHIRIHV
NMKLECSLCHKVFKNPTLLKQHVQRHRKDAVYSCDTCDKKFLTVQKLNKHRKVHHSTGNF
VCDLCGMAFALNDYLQKHKRCHTDKRPHSCTVCGKTFRTKPELRVHVLIHTRETPYKCQY
CSRGFSQKGNYRIHLAQHTGEKPYQCDQCDISFALLCHLKRHKSTHDQKINYRCIWCDKE
CTQRKHMQMHVQRVHKEDFYQHEEQMKLEMPVPIAPAQAKLYNRRIGKANKVRRQYRTKA
QKCDSTIQQLMTGAVQKTEIIDEEMEGSQDIVIEPLVEHMIKTSHESGGYEILVSDDHQN
YAKHSISADLIGQDNVEIVMGENNEISIIIKDPSTLQEVIGDNLETGPVQIHEALQQAVE
AFVIQSKNMQEEVQIPISIEELDKSS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]