dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_013468394.1.50012 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment transmembrane protein, putative [Medicago truncatula]; AA=GCF_000219495.3; RF=representative genome; TAX=3880; STAX=3880; NAME=Medicago truncatula; strain=A17; AL=Chromosome; RT=Minor
Sequence length 289
Sequence
MYNNDVHALLSYHAMTGNSGTLNIMMFHALSFINLAYLPIYVAGPLDPNPVFELDRIVND
LRKKYRTYVVPYSGEHGVAVLPPMFGHDFGDQIGRYATLIDGNNNKFEVLISLGCWVSMF
FVGESKFEITLEDRFRRRMANPRFTPSMKFEIDKDMLPFLMIDDVPRPYVHDPMNFQFSY
EKKLNGDEIDSGWLYYSNSYTFVLIQILAAGEFCRLTLNKRSTSVKLVDDFGNAWFCTLV
YGRRKYAHFKIGGSWRRMVKARGLQRGSHLILGAPKIGNNDTVYFSLIC

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]