dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_013720407.1.73403 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: B3 domain-containing protein REM1-like isoform X2 [Brassica napus]; AA=GCF_000686985.1; RF=representative genome; TAX=3708; STAX=3708; NAME=Brassica napus; cultivar=ZS11; AL=Chromosome; RT=Major
Sequence length 499
Sequence
MTIPPTFSLFHHRFITGDKPVLTVDDEFLRKHTKVLLISDSSDKIWKVKLDGSRLAGGGW
EEFAKAHSFRDGDLLVFRHDGDEIFHVSVSPRSDSCDISHHASPSLVDTDDVETDDDYSE
SDDGEDEYDDDDDGGEDDAGNIMVNKNTKAGFSCILRARVTPYSLIKDRLDLSKDFTVVS
FNEHNKPCEIDLVNEKGRKWTLRLSKNSTSGVFYIRQGWVNFCSANGLSQGDICKFKLSE
NGERPVLRLCPSSNSHEEEEECLEADAVKTSSIRGCSKEKRKGKKKNSPSQFLTVKLTPN
RLQTGQLYISSVFVNESGIKKSGEITLMNKDGRKWPSYLQMTGQCGSEWFYLRHGWREMC
KANGVKVNDSFVLELIWEDDNPVFKFCSKAENKGNGNGRLRKKRACETSIVETERRKRGR
PRVSNTNSSNLQRTRQESCSVSDQVASVKLSILDTLNTVRQFRADIEAREKNLEASSLEV
DALGERILGISQILNNNLV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]