dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_013761279.1.50528 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein AMSG_01764 [Thecamonas trahens ATCC 50062]; AA=GCF_000142905.1; RF=representative genome; TAX=461836; STAX=529818; NAME=Thecamonas trahens ATCC 50062; strain=ATCC 50062; AL=Scaffold; RT=Major
Sequence length 535
Sequence
MKMTMGVLLGVLVMAMVVVNVVAGHPSYMGATPRCQEIMTRMRGADWPSEVLDLKDCYLK
YLPAEVGLLTHLTKLDLTGNDLDELPFNFGNLVNLRELSLWANEWEHVPEELKGLKSLEV
LDLSYMKLKVLPEWLATEFPKLKRFSAHGNGITKMPDSFASLQLEYLNLYNNSLHELPSW
ICEMTSLKELHISHNEIATIPDCIDNLVDLEVLGLWDNDIHTIPESVGNLRNVRLVSFAG
NALHSLPDNLYNHWTHIDDLDLSNNEFSSIPAVVLSMSHIKELHLHGNYLTSDKLPADLR
SLPNLEYLSLGHNRLNSLPPNFLAGLSKLRRLDLSHNSFTEFPAAVAAVAPQLELFNIHV
NDIKSIPDNVLSSMTSMQKLDLRETGLTSLPTSLGTLTQLEVLDIGNNKIGPRLPNFLAS
LVNLRKLAIWSCGLTELPSWIGNLRNLEEIDFSSNDITSFPKSFELCSKLKVLHMHYNQV
SHFPEYLGTFSDLEVIDIYDNPIQHLPTGFCDGSHPVSERMAYWCFALAGGHDEL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]