dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_013967751.1.84170 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: collagen type IV alpha-3-binding protein isoform X3 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence length 727
Sequence
MQRGGGPVPPPLSAPPAAPPCVPGGDPRPAPKGLRSGGGAGRSAGATAAADGWKGRLPSP
LVLLPRSARCQARRRRRGGRTSCPLRPPPAPERALLPSPPPGPSPRLLGASSGAARGAGA
GLPLGCRASMSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNNT
LSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWIDA
IEQHKTESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRDIL
CRQVDTLQKYFDACADAVSKDELQRDKVVEDDEDDFPTTRSDGDFLHNTNGNKEKLFPHV
TPRGINGIDFKGEAITFKATTAGILATLSHCIELMVKREDSWQKRLDKEVEKRRRIEEAY
KNAMTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSQSEKVRLHWPT
SMPSGDAFSSVGTHRFVQKVEEMVQNHMTYSLQDVGGDANWQLVVEEGEMKVYRREVEEN
GIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIVYQTHKR
VWPASQRDVLYLSAIRKIPALTENDPETWIVCNFSVDHDSAPLNNRCVRAKINIAMICQT
LVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKT
AGKPILF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]