dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_014401043.1.60319 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: peptidyl-prolyl cis-trans isomerase G [Myotis brandtii]; AA=GCF_000412655.1; RF=representative genome; TAX=109478; STAX=109478; NAME=Myotis brandtii; AL=Scaffold; RT=Major
Sequence length 752
Sequence
MGIKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHY
KSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTN
GSQFFITTKPTPHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCGELIPK
SKAKKEEKKRHKSSSSSSSSDSDSSSDSQSSSDSSDSESASEEKSKKRKKKHRKNSRKHK
KEKKKRKKSKKSASSGSEAENLDAQPQSTVRPEEIPPIPENRFLMRKSPPKADEKERKNR
ERDRERECNLLNSQPASYQRRLLVTRSGRKIKGRGPRRYRTPSRSRSRDRFRRSETPPHW
RQEMQRAQRMRVSSGERWIKGDKSELNEVKENQRSPVRVKEKKITDLRHVSESPNRKSEK
EKKIKDHKSSSKERDVRRNSEKDDKYNKNKVKKRAKSKSRSKSKEKSKSKERDTKHNRHE
EKRMRSRSKEKDHENTKEKEKSDSKGKDQERSRSKEKSKQLESKSNEHDHNKSKEKDRRA
QSRSRERDTTKGKHSYNSRTRERSRSRDRSRRVRSRSHDRDRSRSKEYHRYREQEYRRRG
RSRSRERRATPGRSRSKDRKRRRRDSRSSEREESQSRNKEKYRNQEGKSSHRKENSEGER
RMHSKNRDHNSSNDNRDKKADRDQSPFAKIKQSSQDNELKFSTLKHKEDEKTRSSVEKEN
QKSKGQENDHAHDKNKKFDHESSPGTDEDKSG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]