dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_014602707.1.41157 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: zinc finger protein 845 [Polistes canadensis]; AA=GCF_001313835.1; RF=representative genome; TAX=91411; STAX=91411; NAME=Polistes canadensis; AL=Scaffold; RT=Major
Sequence length 1095
Sequence
MDVTGDLTLQWVEEVGNVIHEEVICGLEAELVASEEEVIGACEEVTVEETGESVSNVPST
TGSEILMVPQNNDMDSIYIVPQDQGHDYLNIQVTEEVIADNWDRSGPDDGVEIPETKVSN
DNLLEYDDMEIPLPIDQDSYTNIRPYPCDFCSRRFRKKANLMNHMVSHQTDRPHHCNLCG
ARYVRKCDLMNHLKTHAYAPSRDGLDDDLNDDDSLAPEEEETNKGRRKKVQSNAPRKRKN
NSTISKRNNDDVKTEMSKYVNKSYDYVDEDMRLLEEMTNRNPVRGNNYPSSSRWNEQISP
VSNEQQPPRWPITDPTKPYVCQYCGVGFAREKALASHARVHGGDSPFECTSCSEMFWDVN
SLREHVRIKHGGTTQLDIEDYDTNDATYTGDERFGEFYCNTCGVPFHRLDLLKRHQKIHV
KQEMDIMEGSSQHHVCNVCGEWFEEALALLAHAELHARSPSRRCLLCGERCRDDAEVAEH
VRLNHAEDAPPNTCTLCGKTCKDKRSLLKHSWVHNVDKTFGCTKCGKRFHSKARLRRHMV
SHRNKMVACDECGEEFPDGRALVSHRHSHNKDLGGRSFPCRECGKTFGSRSSQQIHIRIH
TGERPYGCRFCWKAFADGGTLRKHERIHTGEKPYGCAICPRAFNQRVVLREHVRAHHSGP
DPKCVGSITPYLCKVCGDAYATSEEIVAHIVQHCDDNTALRRQPQTGPRKYKRRRKLKPH
ETTTMLRINENFDTLEGGSDSDDNTKRKLGRKNKQHRSNVEEGYQNVLKSFESSLQNINS
IVSNSKLNPAKSKLSKKKLRKEEKKNEGQTSCQSGRPKMIHTQKTRVPVEMGSDGVKKGQ
KTKTMVTRTPKVMPSEHKLGIFTGGERNRPRTKNVSYHIEGKLQLTPATFPKLKEENVKL
STQVQPPILTNIKIEPGVQKSVDSNHSNNHSNIVKINSDKLDRTSRKKSTVFKKIKKQKQ
INIKEEPNENVNEVETQNNNNTENTNSIRLMEEHTVDGGSLEVAFEASVVTAEEETILPD
IDTVTTNDNIGNGNVQLSVKVESTPQRILAVHSVITPVDEVAETIIPDTLEYTCEMCSMV
FSSRAELLVHVPIHI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]