dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_015639973.1.37577 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: nuclear pore complex protein NUP50B [Oryza sativa Japonica Group]; AA=GCF_001433935.1; RF=representative genome; TAX=39947; STAX=4530; NAME=Oryza sativa Japonica Group; AL=Chromosome; RT=Major
Sequence length 472
Sequence
MADEEHAPTSRKRVAGTQINKDNPEPDDDSTEQEMGTFKRASEEVMATRRIVKVRRQQPS
SAPSNPFSAIRFTPSDTSAQATIPVSEPQPSDVITANAKDSSSEKADEGSNGSGKDALPV
TDKSAGSSEVAETEKDGSDLKGSDEKAKSSDSIEPPSQPVETTDEAKDLGGGSVVAGEAK
EDNSKASDIEDKTAKEGDAEEEDGANEAGAEDKISKGDDEKKDGDESETKDGSSEEQKDA
DNKGQSSSPTPLFSFKNLSSGQNAFTGLAGTGFSGSSFSFGSGSKESSSAPLFGLKTDGS
SFPSFSIGASNNGSSSPALATSAEAPKKFAMPEGPVETGEENEKAIFTADSALYEYLDGG
WKERGKGELKLNIPVSGGERSRLVMRTKGNYRLVLNASLYEDMSLKDMDKKGVTFACMNS
IGDSQSGLATFALKFRDTSIREEFKAAVEMHKAKKASGTLKTPENSPKASDD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]