dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_015730722.1.68032 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: plexin-B1 isoform X1 [Coturnix japonica]; AA=GCF_001577835.1; RF=representative genome; TAX=93934; STAX=93934; NAME=Coturnix japonica; AL=Chromosome; RT=Major
Sequence length 2233
Sequence
MGEDLGFPERQREEPVSPVHLVAVRLLRVFTMPLGTILLPILCFLGVAIPRGLQYVTFSR
NATRFLHLSMDSESGTIYLGATNFLFQLTSDLLMENMVQTGPVLDSKDCLPPVSKLECPQ
AHHTDNHNKLLLVNSVQKELIVCGSVHQGICEKRSLTSIDHVLFRPESPGDTQYVAANDP
NITTVGLVAYSKDEVPLLFVGRGYTSRGVGGGIPPITTRNLRAHGSDVQATDSHSIFSYE
ETAKLAVGRLSEYNHHFIKSFTYRSSVYFLFYRRDLKSQSREYKTYISRICLDDSHYYSY
VELPLLCQGKTNTYSLLQAAYVTQPGKDLAQGQLDTDGEVLFATFSAWQASSGKLSEESA
LCIYAMEEVDRLTNWTRDVCYMRDGKSEDGAEVAYIEYDVSSNCVQLPADTLYAYPCGSD
HTPSPMASRVPLEAAPLLETTESRLTAVAVNVEDGHTIAFLGDSKGRLHKVYLGAMGDAH
IYASLAIQLNSVVSGDLLFDQLQEHLFVMTQSMVLKVPILECSLYADCESCLALKDPYCG
WCVLQGRCSRRSECLRSGLSEQWLWSFNSTQQCLSIQSLTPANISREEKRNIFLAISDLP
SLREEEFYSCYFQDYESPAVLTESGIMCPSPDPNQTPALPAGADHVTIKLVVRFHDIFIA
SVDFSFYDCAAVALLWKSAPCQKCVSSPWGCNWCVQQHLCTHKAACEEGTIIYNERAQIP
TSSVFLSSAAPLTKSSTVAPVVTIKPITPPVHAVSNTVPPTEPNHITFSAASDSMTEPTE
IISNPYSTLSAEAASLQAVTEHPLPPPADKPAVTLPGTASPAASILTSPGKNMDRAALPT
IGPSAAHEPWHTEPPTTVAATPLFTSSPAVTPSPHVTSLRLPLSSFPTAEALTSAIPSPQ
TPGQMPEDPSASNDSPAMLGTEIPASEPPPSASQDSVLGEDAELQDTEDWMDLLQAENDT
SPFSASTLLSGDGDSSERDVPDLPRILHPDLDYQYDAPGFWENEELSWGPGACPCVQGIQ
GSSLFPVNVTRKITLLGKNFHLYRDQRWDYECVLNLEGRTMVMDAYVEGDEANQSLCYIT
CQLNQYSYTAPQLEFNAVVFVQRRQHLRVDSAADLHVTFYNCSVGHTDCSRCQTADSKYN
CVWCGGDKPSCIFRGSCKEEIEDLCPAPLIHSVYPLSGPVEGGTRITITGSNLGQKHQDI
AETVTVAGIPCAVDAQEYEISSSIVCVTGGSWAERVGHVVVEVPGGGRGVSEHIFTYQNP
ELRSIVPTQGPKAGGTCLTLLGSKLLTGHPNEISVLLGDLPCHILSEMTEDQLACQTSPS
NVSTELPVTIKYGEQERRLEGSLFRYTLDPNITFAEPPKSFLSGGRVLRVHGFNLDVVQS
PKIRVTVSPSERRRRGLGRWRRIIPDTECPKDALCSIQQFEEPCLVNSSYLILCKTPAIN
LLLRSVHIKLEFILDNLSFDFNSLHPIPFSYEVNPILKPLNAEDPAKPYRHKPGSVISVE
GENLDLAISKDEVMAMIGEGICVVKTLTRNHLYCEPPSEQPAPRHRTKREGTDLLPEFTV
QMGNLNFLLGRVQYDTESQLTFPLEAQIGLGVGASFVALIVLVIVFIYRRKSKQALRDYK
KVQIQLENLETSVRDRCKKEFTDLMTEMMDLTSDLVGTGIPFLDYKSYAERIFFPGHRES
PLQRDLDIPECRRQTVEQGLVQLSNLLNSKLFLTKFIHTLEIQRTFSPRDRAYVASLLTV
SLHGKLEYFTDILKTLLNDLVEQYVAKNPKLMLRRTETVVEKLLTNWMSICLYAFVRDSV
GEPLYMLFRGIKHQVDKGPVDWVTGKAKYTLNDNRLLREDLEYRTLTLNALTQAGVAAGG
AEDSQGISAKVLDCDTITQVKEKILDQIYKGMPYCHRPDPDTLDLEWRSGLAGHLILSDE
DVTSVVQGTWKRLNTLQHYKVPDGATVALVPRLTKHIHRENQDYIPGEKTPMLEDADEGG
IKLWHLVKPTEEPELPKHRRGSLRDRERAKAIPEIYLTRLLSMKGTLQKFVDDLFQVILS
TSRPVPLAVKYFFDLLDEQALHYGIADPETIHIWKTNSLPLRFWINIIKNPQFVFDVQTS
DNVDAVLLVIAQTFMDSCTIADHKLGRDSPINKLLYARDIPRYKQMVERYYADIRQTISA
SDQEMNSALAELSRNYSGDLNSLVALHELYKYINKYYDQIITALEEDPTAQKMQLGYRLQ
QIAAAVENKVTDL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]