dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_016156519.1.66865 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: endophilin-A3 [Ficedula albicollis]; AA=GCF_000247815.1; RF=representative genome; TAX=59894; STAX=59894; NAME=Ficedula albicollis; AL=Chromosome; RT=Major
Sequence length 318
Sequence
MERKIDVTNKAVTELLSKSTEYLQPNPAYRAKLGMLNTMSKIRGQVKTTGYPQTEGLLGD
CMIRYGRELGDESMFGLALLDAGESMKQMAEVKDSLDINVKQNFIDPLQLLQDKDLKEIG
HHLKKLEGRRLDYDYKKKRFGKIPDEEVKQAVEKFEESKELAERSMFNFLENDVEQVSQL
AVFVEAALDYHKQSTEILEDLQSKLQNRINVASSRPKREFKPKPVITTTLEIGDNQQHNG
IAYSSSIKSSGSSVHMDQPCCQALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLNG
ESGFFPINYVEVIVPLPQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]