dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_016354944.1.79318 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: plexin-D1-like [Sinocyclocheilus anshuiensis]; AA=GCF_001515605.1; RF=representative genome; TAX=1608454; STAX=1608454; NAME=Sinocyclocheilus anshuiensis; AL=Scaffold; RT=Major
Sequence length 1897
Sequence
MPPSTANRSSLGLLATVFAVFLTALQTRTAAALQIQQAFASPSRTNNFVVDAVSRRVYLA
AVNSLYQLNATLAREVETRTGPVLDNPLCHAPQLPQATCEHQKTLTDNHNKLLALDREQG
VLLACGSVYQGFCELRSMDNVSRVAVKFPQDGATVFPSMLNIVANHEKASTVGLVFRSHG
GAPRLLVGATYTGMGTEYFPKNHSKEDLRFENTPEIAIRSLNTKDLGRLFTYDINPSEDN
VFKIKQEVKQKNKLNFVHAFVHKNYSYIAINNDANTGLKESQPNSILARICLDTDDPRRS
AESRKLTESYIQMGIQCGSNGNIYNRLLSIYPVDISAQRAAGPEPYLFGVFARAGGQSAV
CAFRVAAVEEMIRQGRRNCSSGPNSDVQVLDSVIQGSGAECERKGAIKLQEEQLNCGAAH
LQHPLALRKPLRAPPIYEAPGLSSIAVDNVHNRTVVFLGTNRGRLRKLSLLANLSVANLW
SLRLAANEPVHHIMTFDSSDHNYLYLMTTHHLLRVQVSVCGLYSSCRECVSAGDAHCGWC
TLERRCSVQKDCSSGTLGRSWISTGDGVQQCPSMTIIPSEISRSAHMRDVGILINGSVPD
LQGLQLECDYGVGITTNATVHLDYGTTQIQTCPLLPPHMYPTIPFGKDHVTVPVAIRVNG
VTVVSGSFIIYECELTGEIHYKTACTSCLSAAWRCYWDPQLSVCVSSKVNTPHALLENSL
YCPRMLAYDVPPLPTGSTHVFSLELKNIEHGIELDCDFGDGQLCRAQWLDGLSVNCSRVI
LKTTMWSKIFNLNLRRRGTSTYIDSPKTMTVEVYSCSAGDSDCSQCWGRQAQGHICVWCE
NSCQQREQCHSITTRCPDPHIQKVEPLSGPLTGGTLLTVQGKNLGHSAAQINVSIGHVPC
RILPQLYTVSVRLVCETGASWEQTSDHVTVSVAGNAVGVSKDIFSFVEPRLLEFRPRQGP
LAGGTRLTIHGLFLDAGSTVNVKINRIQNCTVFMLSSDVIECVMPPAEAATAENVSVCVV
YDSQPCLSASPSFTFTYEKNPTISHIRPNRSFLSGGRSISVTGQGFNLVQSVRMEVSEVG
QTICSYVSSTLIVCQSPATNQSQQATAHFYLNEVLYRGEDASPSGRGPDEDEEPHADAFH
FDYVEDPQFYTANKEKLIKHHPGEPLILIINKGPSELDLTLQEYSVTIGSDLCDITFHNE
QLFHCTINRSLSTSTGELPVTVRVGHFRKVIAMVQMGGGSELAIIISIVVCCVLLLLCTV
ALVVYCTKSRRAERYWQKTLLQMEEMESQIRDEIRKGFAELQTDMTDLTKELNRTQGIPF
LEYKQFVTRTFFPKMCSDYERRLVQPVYENNPLGPRALSETHPLLQDWQSSNRMRPNLEE
GITLFSTLLNNKHFLVTFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTSIMKELLV
DLIDASASKNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLCAIKQQINKG
SIDAITGKARYTLNEEWLLRENIEAKPQNINVSFQGFGMDSVSVRVMNTDTICQVKDKIL
EAFYKNLPFSQWPREEDVDLEWFPEGRSSRILQDLDDTSVMEDGRKKLNTVFYYQIPDGA
SLAMSMKDKRENTLGRAKDLDTEKYVHLVLPHDEQTESRKSHRQSHRKKVLPEIYLTRLL
STKGTLQKFLDDLFQAILSIPPEKPPLAVKYFFDFLEEQADKRGITDPDTLHIWKTNSLP
LRFWVNILKNPQFVFDIDKTDHMDACLSVIAQAFIDACSLSDLQLGKDSPTNKLLYAKEI
PEYKKRVQCYYKQIQEMAPLSEQEMNAHLAEESRRYRNEFNTNLAIMEVYKYAKRYRNQV
VSALDSSPTARRTQLQHKFEQVIALVEDNIYECSSEA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]