dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_017026774.1.37106 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: zinc finger protein 646 [Drosophila kikkawai]; AA=GCF_000224215.1; RF=representative genome; TAX=30033; STAX=30033; NAME=Drosophila kikkawai; AL=Scaffold; RT=Major
Sequence length 1323
Sequence
MNNQDYGGIQWIQHHPAAGDSSETDIMEHEDADGDDMVSGADGDPDGDGDADVDLDHMAA
ENLIFMARDGQLGEIIAANEGTVLVTADGTTVAYAESFDDDAQVVTEEVITDDWVQHQGA
ERVEIAAEQIAGISSSQELLDMEQDEYTALRPYPCDFCSRRFRKKASLNNHMLAHQNDRP
HLCKLCGARFSRRAELISHFKAHAEAQDAADAEAAAAAAAVSGSSSIKFENQSHRQTDDH
YYEQEWPLYQQQHQQQEQEQQQELGQHEQMLQQEQQQLVCNSEVQFVASYTASVAPPPAP
SRGRISRLKPKEESSQFIVITDKPAPSELRDYMASEPVPQPVVPTSQPMAIDAPPAPQPN
FPVLDDSKPFVCQQCGLAFAREKALVSHTKNHRVDSPFECNQCQEMFWDNSSLQDHQKTH
QFEESNSEYDPASGEDSASETSEPEDQLYGEFYCNECGISFHRQDLLRRHAKQHFKQQDH
HSTVAAGDGSSSDVIASGDQAKEGNDGHCCQTCGKSFPSAAEMLSHAEIHARFPPFKCVL
CGISFYEEQAIKRHLHARHPNELKANSCVLCGKECRDRKALIKHAWDHSREKCHSCSKCG
KNFHNKARLKRHMASHRDKSVVCEVCQEEFPDGRTLSNHRHSHSTTSPGKLFPCHECGKT
FGSRSSQQIHVRIHTGERPYGCRYCWKAFADGGTLRKHERIHTGEKPYACSVCPRAFNQR
VVLREHIRSHHSGLDGARNTYHCTVCSEDLASSNDLIQHLIQHSDSNTAKQRQPVTGPRK
YKRRRKLQPHEIAHMRAEHKDANGGGDEEEILGAEGNGDGDEYASDIDLCDFDVENVDDL
FEMAESSPKKEKRKRASATSVKTEQKPISNGGGSAVKPVQEKNKAKLRYDSTSSQQSDRI
WEEKFLQDSQVSLFQIDSLVVVNDTHLQPASSAAMPKTRGGAKQQQQQAKQPVERASNSN
PSAASSVGTSSASASASTSTSSSRSRKKTAAAKTAAASRPRMIHTEKTKVPAKETAGGEL
AKKTRSKTYITRTETSNLGSLDKSRSRASNIVDDYEIISPATHPPNQISSSPLHIKQEQE
QQHRVPMMYDDNLLIDAALLREKTYEKFNPSIVNDLEEILRSPLKHERNTRLRFTSESST
TPQFLPEEEQNLIKIEPTSPDLREMLESQSQRVRVPSGNTPSTSSSSAARTSRHRMITAS
GPRAGNKRGAGSGSSASKSSPAPGVMAKKVSTAASKVGGSSSYLNYGVDAYNVSVPASAS
TADVGSGFFSISEVVSAADAADAAAKAAAAGKPERKTRSFECEMCSAIFYDRAQLLDHVH
IHI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]