dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_017353328.1.71028 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: zinc finger protein 791 isoform X1 [Cebus capucinus imitator]; AA=GCF_001604975.1; RF=representative genome; TAX=1737458; STAX=9516; NAME=Cebus capucinus imitator; AL=Scaffold; RT=Major
Sequence length 576
Sequence
MDSVAFEDVSVNFSQEEWALLAPSQKKLYRDVMQETFKNLASIGKKWEDQNVEDRHKNQG
KNLRSHMVERLCESKEGSQCGETFSSSLCVTKKTARVKLDECTVCGKVFMRRSSLTRHMR
SHTGYELIEKPYKCKECGKAFSYLKSFQRHERSHTGEKPYKCKQCGKTFIYHQPFQTHER
THIGEKPYECKQCGKALSCPSSLRIHERIHTGEKPYECKKCGKAFSCPSSIRIHERTHTG
EKPYACKECGKAFISHTSVLTHMITHNGDRPYKCKECGKAFIFPSFLRVHERIHTGEKPY
KCKQCGKAFRCSTSIQIHERTHTGEKPYKCKECGKSFTARPAFRVHLRVHTGEKPYKCKE
CGKAFSRTSYFRIHERTHTGEKPYECKKCGKTFNYPLDLQIHERNHTGEKPYECKECAKA
FISLENFRRHMITHTGDGPYKCRDCGKAFIFPSALRTHERTHTGEKPFECKQCGKAFSCS
SYIQIHERTHTGEKPYECKECGKAFIYPTSFQGHMRMHTGEKPYKCKECGKAFSLHSSFQ
RHERIHSCEKPLECKQCGKGFSLSTSLQKHMRMHTR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]