dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_018079546.1.7800 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: uncharacterized protein LOC108695499 [Xenopus laevis]; AA=GCF_001663975.1; RF=representative genome; TAX=8355; STAX=8355; NAME=Xenopus laevis; strain=J; AL=Chromosome; RT=Major
Sequence length 2154
Sequence
MQGKERSTTALDGCVTTRQRLSSATNQDPDVALGSASDTGQYLCMECSETFSSKVQLSSH
RQSHVAKKPFMCSYCGRGFHHQIFLQVHERSHEGGATSHQLTAVKPGASRVISTRSCRTV
APLTSDCVNVQPIPSKPELLLNSLVQFRKGHGSQQSPAPIECVTRLSRSQAQPCAQRKDS
AEKRSPIELRVSRFSDTTVHLMDAFGNSIELLTEVFSTYTMNGPKQNPATHVPSSVDSTP
CEQRTDRTQQEKNDGETLTSNNLQSHMPPQLVPHTDTPTVCPIETDVGKMESDFSPGAVV
CSAAPYITTSETPMHNESERLTSGDPELPIETLDDPIETLDDPIETLDDPIEALDDPIET
LDDPIETLDEPIETLDDPLSKGTEPISVPHVITYQVSTELDSPLDGITVSSPPTYSQSVL
PSKGHDGPGTNSTEQTDSVPEMDSLEETHNFLVPYEQKQKGSLLAEVTSVLQAEDVRVPG
TAQAGGLPEYQQRAAPTDHSEQVGEIDACSVGISTLRTDIAMTSELDSQSDVGNGDHKIV
LGQSTQSGVKGVSLVPVNIKQLPSHETAIDLKLSLVQDAHSAATVQGTNCSRGTETTSAN
VGVGHQHGQDLHCERNAQPVMVYNKAEDGSFPKPHPETGAGDASEMEAAENDQAPPTKKD
DYKLIHTNSAASLCDQEPTVPESQDKDDQVSATYRHGQDLRSQEPDRTHAESLDPAIVDH
DYSDLRRTLKDTPVLCSPITVEMAREFGDGQCDESHIVAGIHDAPPIGEKNNAQHGEQEQ
HLLDKRPDLQEGISGNVEKFAESGTAETALILSKDGEPQAMGDLHPHDIMDSTLTGPQPE
RAECKEDISRWVSSMEASLQEKGVAHETEKGTNTHIGPLAAFIPSSHHNETELNCVAKRS
LCKSAPTERKEENKADVALSPSVTNEVELEGTVPCLTCGQHVNGNKSPSHVCSNFSKSSM
TVMESKRIEMIPADVKRDLDSITEPPSLEPEEPDAKVNKMYNCPKCDKTFRLPVLLAGHV
KCHSSHLCITCGSPMPHKYKMKRLARKCQQCIQNTIVKRQEKRLLSSHYSEEEDMVTSGT
GFSTELNEEADLTLSCAPNTEDVLGANSAIELTQPKRPCIKQRAKSADGSLGMEPSIECS
EVRKKRGRQPAKGDVIPATVPKVYKCLQCGVSFLQCMFIVKHMKEHSMTQTQPCKCYLIV
RRGGKQTLKQCKICREHTKSTALDASQLTGSASEQNLHIHTLGPKKIIKRVRKGDVPFQR
PGDKKIPLKQRKYGRKSMAPVRECHDEPHLEKKSQIPPLDGNAELMSTNWEESIGEQSVS
GRGTDKRSEDLLLKPHVCDVCSKAFRLPRYLRLHSVSHTGTLCASCGCLFRYKRRAGRPS
KKCRLCRMKGRERRVLSKTILEPNLPELPKAHKAEVLSSLPHGKQSKILAKLKAPIQAKL
SEAFKKKKFKLLKGPQGHSKKRKLNSMQLEKRKKKLKSIEDLSPPTPKKRGRPPGKPTAH
RMLSTVNSPAIKSEGTSVAVSDDGLHPIETTKNNFSGDGKSDEVPTYQILPTMSIKEEPN
SSEISSFQCSECGQNFPYKHLLDNHMQTHTGDRPYVCSDCDKCFAKINHLTIHKRVHTGV
RPHVCSVCQRSFRQKSSLLAHRYTHTNQPPLLVTSYECSVCLKEFKQNSDLEAHECILPV
ELPVQCKDCNRVFTNKGRLAVHSRVHTVQTSYPCPICNRSFIYKANLERHQQKHKGEKPF
SCAKCGVSFARRKTLERHKLAHGKKGLFSCIHCKKYFLLQTWLFRHLKICQGVNKGKVLK
VQKRKKIKEDVEVSSTVSSEEAEKKIIKVENKEQKIKKIMKSKVLGEAKLKSKAAEGSKE
EKLKVKATKAEKGTLKKKLTEGGQEKGEGSSVEEEKKPNEQDNEKKGNKQEQIKKGQREF
PERANTSDGKPKAKCAAPAKKELLSEEKQKAKSAKKDMLGEEKQKAKGAKKNMLGEEKQK
AKGAKKFMLEEKQKAKGAKKNILGEEKQKAKGAKKDMLREEKQKPKGAKKHMLGEEKQKG
ATTAKKESNGEEKQNVKVAAPTNFELLGEEKLIGKGATTTKKESEEEEKQKARNVIPAKK
ELIGDEKQKTKGTPPAKKPRLESYPKVATPERMRKEDGKGKEPQGKLQSGTGKK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]