dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_018274677.1.32311 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein RHOBADRAFT_51073 [Rhodotorula graminis WP1]; AA=GCF_001329695.1; RF=representative genome; TAX=578459; STAX=29898; NAME=Rhodotorula graminis WP1; strain=WP1; AL=Scaffold; RT=Major
Sequence length 1422
Sequence
MAAPPVAPATPTRDHDPASLRSPIVLSTRSPAAPRPASVLIQNVRGAEGGVEAITARRRN
SGSFKTMSTGGLVSNSPFAKRLGQTSPTKSAASSPTSTLYTSSRIPAPSSSSTSGGASSA
RRTSGSRQSSGEQEQGPVKENSIPSDLNELATAKDDDSKSRSSSPAVPFRPTRQQAPASS
PFKPSRSPIDEPAQPRRQTSSYAHLRSNNLVSSSPFTAQQAAPSPELQQVPYEIGALTLE
SAPMELFYDDSSSAGDRSPHLDVGLGARPGQGVLGPVSRHAAGASAPPPVSPPPPSSTST
SSAMAPVRRGMRGPRPLSGDAADDLAEEQGRVVRRQPSSKSVAWAETEEVFEFEVEEERR
RSMMSDASGLSDEGYYGRRGAGEEDDEDSSFEDDGYGAQHASYSFEEGGSVEVHDVDDGA
SDAEESVVSNTSSAMDEVIGQIDSYLHEESYDAADVFSPSQILDGDHDHGEFADQPDLPT
HHDTSGYSSPAVPQQRGPVSAFSVSTADDGASDVMSTSAYGDDDDQDERDAHFDATRQAI
MGRALGAPVPPVPMSPGRPPLPPRPASATSPATRADPIPGSLLAHSDSQFSLPDIPGTSP
FMGFEDDGTAGSVVSLANNAKPHAAATVPTTRPLSLHSHMAVATSTPVKAARAEPAEETT
PTKSTPSSTATRGLGLAPSSSAGSPILAALHRSPDAATATLVPPGSASPALSRKASLVGS
DVTTSSTSWYVSSVTGSLRGGRIGSGLESTMKRHEAILGSPFMPSSSGAFGAFPKPSTPA
PALSVETASPARSASTMGSTGKSTPPTSHASTAGSSDAAGGGVAPRSLKSARAIEARPAL
KAHGATLSSGMMPTIAASSQRAQLGLSVGSPLTARVAEEMQSPLERLQMGVQGRGEGAEW
RDGDSLLGGAEGDEAGDEVSSLRPGAGAGAGGAVKRLQRRRSRSTGDADLAETTSSVGAQ
HTMPELGFEQQRGGEGGAFGSSVLESLDDIYNSRNRTYRVRESKHLVVVSDIAGHTAGDV
DPGKAWRKKRPSNVHEINRSMSTMSVNSQAVRKNREFAGQLFVLIREASFEGMPLPRTKA
MVTATLDNGRQRVDVAVRELGNKVSLRKEFELACNQDLAFSIDFSVPRQTPVSTPVLPST
PSVPAPTPPASPSKAHRAFRIFSSPKKKAAQAPARPTSTLAAAPPPTPDPFYDYVSSNGQ
LATAHVTFATEAAACRLKKTRVVLPFGAKTVGSPRSCSGSLEIDLLFVPAVQGVPKAHLP
KSMDEVLDGLERADFATKVVHESVLTQLGGDTTVWRRRVVKLRGSTLVPYNEVTKRSHVE
INLAQVVAVEDLNAPSSTSRAAARDDDDDDESVTRMDHSFRLVFEDGNRIDYFADSHAIK
TKWLEVLAAVVGQDGDKKTAPDWAVAVRKLPPPKALALKAAA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]